PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013627950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 252aa    MW: 28910.7 Da    PI: 7.2964
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013627950.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.58.2e-153784148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ eE e+l   + ++G ++W++ ++  g+ R++k+c++rw++yl
   XP_013627950.1 37 RGPWSDEESERLNAFILKHGHHNWRSLPKLAGLARCGKSCRLRWLNYL 84
                     89********************************************97 PP

2Myb_DNA-binding54.23.4e-1790135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
   XP_013627950.1  90 RGNFTKEEEDTIIHLHQVLGNK-WSKIASHLP-GRTDNEIKNVWNTHL 135
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.973284IPR017930Myb domain
SMARTSM007174.2E-93686IPR001005SANT/Myb domain
SuperFamilySSF466895.62E-2936131IPR009057Homeodomain-like
PfamPF002495.6E-133784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-203891IPR009057Homeodomain-like
CDDcd001674.56E-73984No hitNo description
PROSITE profilePS5129425.22185139IPR017930Myb domain
SMARTSM007173.0E-1589137IPR001005SANT/Myb domain
PfamPF002495.7E-1690135IPR001005SANT/Myb domain
CDDcd001671.49E-1092135No hitNo description
Gene3DG3DSA:1.10.10.605.4E-2792138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MCVYKHEYLK DSLKLKTMCV MGKRRTPCCD NSQVLKRGPW SDEESERLNA FILKHGHHNW  60
RSLPKLAGLA RCGKSCRLRW LNYLRPGLKR GNFTKEEEDT IIHLHQVLGN KWSKIASHLP  120
GRTDNEIKNV WNTHLKKRSV KSNSASDVTN QASSVSSSSS SVSTDVINSE KHNQEEELEN  180
ILVEHIACGF EVNAPQSLEY LFEDRQIPPL SISKPDSLEI HMQSDDDLCS RMVEPGLDVY  240
NEWLSYFDNQ TL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25351385107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195861e-114AY519586.1 Arabidopsis thaliana MYB transcription factor (At3g12820) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627950.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0D3BB031e-176A0A0D3BB03_BRAOL; Uncharacterized protein
STRINGBra001472.1-P1e-153(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140961624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12820.11e-113myb domain protein 10